ID3 (1R21, BHLHB25, HEIR1, DNA-binding Protein Inhibitor ID-3, Class B Basic Helix-loop-helix Protein 25, Helix-loop-helix Protein HEIR-1, ID-like Protein Inhibitor HLH 1R21, Inhibitor of DNA Binding 3), Clone: [4G1], Mouse, Monoc

Artikelnummer: USB-128205
Artikelname: ID3 (1R21, BHLHB25, HEIR1, DNA-binding Protein Inhibitor ID-3, Class B Basic Helix-loop-helix Protein 25, Helix-loop-helix Protein HEIR-1, ID-like Protein Inhibitor HLH 1R21, Inhibitor of DNA Binding 3), Clone: [4G1], Mouse, Monoc
Artikelnummer: USB-128205
Hersteller Artikelnummer: 128205
Alternativnummer: USB-128205-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa1-83 form human ID3 (NP_002158) with GST tag. MW of the GST tag alone is 26kD.
Members of the ID family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [4G1]
NCBI: 002167
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.