ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1), Mouse

Artikelnummer: USB-128201
Artikelname: ID1 (Inhibitor of DNA Binding 1, ID, Class B Basic Helix-loop-helix Protein 24, bHLHb24, DNA Binding Protein Inhibitor ID-1), Mouse
Artikelnummer: USB-128201
Hersteller Artikelnummer: 128201
Alternativnummer: USB-128201-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: IF, WB
Immunogen: Full length human ID1, aa1-155 (NP_002156.2).
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 002165
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.