ICOSL (B7-H2, CD275, ICOS Ligand, B7 Homolog 2, B7-like Protein Gl50, B7-related Protein 1, B7RP-1, ICOSLG, B7H2, B7RP1, KIAA0653) (PE), Clone: [2D12], Mouse, Monoclonal

Artikelnummer: USB-128197-PE
Artikelname: ICOSL (B7-H2, CD275, ICOS Ligand, B7 Homolog 2, B7-like Protein Gl50, B7-related Protein 1, B7RP-1, ICOSLG, B7H2, B7RP1, KIAA0653) (PE), Clone: [2D12], Mouse, Monoclonal
Artikelnummer: USB-128197-PE
Hersteller Artikelnummer: 128197-PE
Alternativnummer: USB-128197-PE-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa20-303 from ICOSLG (AAH64637) with GST tag. MW of the GST tag alone is 26kD.
B7-H2, or Inducible costimulator ligand (ICOSL), is a member of the Ig superfamily and belongs to the B7 family of costimulatory molecules. It specifically binds to ICOS, but not to other T cell costimulatory molecules such as CD28 and CTLA-4. B7-H2-ICOS interaction appears to be very important in the expansion of activated T cells and late-phase immune responses. B7-H2 enhances the proliferation of both CD4 and CD8 T cells, the secretion of Th1- and/or Th2-type cytokines, and the expression of CD154 (CD40 ligand) on T cells. It is expressed constitutively on B lymphocytes and at low levels on monocytes. Furthermore, B7-H2-ICOS interaction induces IL-10 production, which plays an important role in reducing immune responses. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIG Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2D12]
NCBI: 064637
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).