ICB1 (THEMIS2, C1orf38, ICB1, Protein THEMIS2, Induced by Contact to Basement Membrane 1 Protein, Thymocyte-expressed Molecule Involved in Selection Protein 2) (PE), Clone: [1C3], Mouse, Monoclonal

Artikelnummer: USB-128191-PE
Artikelname: ICB1 (THEMIS2, C1orf38, ICB1, Protein THEMIS2, Induced by Contact to Basement Membrane 1 Protein, Thymocyte-expressed Molecule Involved in Selection Protein 2) (PE), Clone: [1C3], Mouse, Monoclonal
Artikelnummer: USB-128191-PE
Hersteller Artikelnummer: 128191-PE
Alternativnummer: USB-128191-PE-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA
Immunogen: Full length recombinant corresponding to aa1-111 from C1orf38 (AAH31655) with GST tag. MW of the GST tag alone is 26kD.
Involved in cell adhesion. There are 4 isoforms produced by alternative splicing. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHIFSSLRIAATRSAAQTQGEDLARVHQGWLQYVQQDSCPQEGPQAR Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1C3]
NCBI: 031655
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).