ICB1 (THEMIS2, C1orf38, ICB1, Protein THEMIS2, Induced by Contact to Basement Membrane 1 Protein, Thymocyte-expressed Molecule Involved in Selection Protein 2) (MaxLight 650), Rabbit

Artikelnummer: USB-128190-ML650
Artikelname: ICB1 (THEMIS2, C1orf38, ICB1, Protein THEMIS2, Induced by Contact to Basement Membrane 1 Protein, Thymocyte-expressed Molecule Involved in Selection Protein 2) (MaxLight 650), Rabbit
Artikelnummer: USB-128190-ML650
Hersteller Artikelnummer: 128190-ML650
Alternativnummer: USB-128190-ML650-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human C1orf38, aa1-132 (AAH81568.1).
MaxLight(TM)650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. Involved in cell adhesion. There are 4 isoforms produced by alternative splicing. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MHLGIRSARCVLGMEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHSELPGQMDARCWGRERGLPLGAALMEDTPTPSLRISWNFRLLPLYYTEVILFF Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 081568
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)650.