ICB1 (THEMIS2, C1orf38, ICB1, Protein THEMIS2, Induced by Contact to Basement Membrane 1 Protein, Thymocyte-expressed Molecule Involved in Selection Protein 2), Mouse

Artikelnummer: USB-128189
Artikelname: ICB1 (THEMIS2, C1orf38, ICB1, Protein THEMIS2, Induced by Contact to Basement Membrane 1 Protein, Thymocyte-expressed Molecule Involved in Selection Protein 2), Mouse
Artikelnummer: USB-128189
Hersteller Artikelnummer: 128189
Alternativnummer: USB-128189-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human C1orf38, aa1-132 (AAH81568.1).
Involved in cell adhesion. There are 4 isoforms produced by alternative splicing. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MHLGIRSARCVLGMEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHSELPGQMDARCWGRERGLPLGAALMEDTPTPSLRISWNFRLLPLYYTEVILFF Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 081568
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.