RNF217 (C6orf172, IBRDC1, Probable E3 Ubiquitin-protein Ligase RNF217, IBR Domain-containing Protein 1, RING Finger Protein 217, MGC26996, DJ84N20.1), Clone: [4B1], Mouse, Monoclonal

Artikelnummer: USB-128181
Artikelname: RNF217 (C6orf172, IBRDC1, Probable E3 Ubiquitin-protein Ligase RNF217, IBR Domain-containing Protein 1, RING Finger Protein 217, MGC26996, DJ84N20.1), Clone: [4B1], Mouse, Monoclonal
Artikelnummer: USB-128181
Hersteller Artikelnummer: 128181
Alternativnummer: USB-128181-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Immunogen: Partial recombinant protein corresponding to aa2-101 from human IBRDC1 (NP_689766) with GST tag. MW of the GST tag alone is 26kD.
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates (By similarity). Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [4B1]
NCBI: 152553
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.