HYOU1 (GRP170, ORP150, Hypoxia Up-regulated Protein 1, 150kD Oxygen-regulated Protein, 170kD Glucose-regulated Protein) (APC), Clone: [6F7], Mouse, Monoclonal

Artikelnummer: USB-128179-APC
Artikelname: HYOU1 (GRP170, ORP150, Hypoxia Up-regulated Protein 1, 150kD Oxygen-regulated Protein, 170kD Glucose-regulated Protein) (APC), Clone: [6F7], Mouse, Monoclonal
Artikelnummer: USB-128179-APC
Hersteller Artikelnummer: 128179-APC
Alternativnummer: USB-128179-APC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IHC, WB
Immunogen: Partial recombinant protein corresponding to aa901-999 from human HYOU1 (NP_006380) with GST tag. MW of the GST tag alone is 26kD.
HYOU1 belongs to the heat shock protein 70 family. The protein is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This signal peptide-lacking protein, which is only 3aa shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [6F7]
NCBI: 006389
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).