HYOU1 (GRP170, ORP150, Hypoxia Up-regulated Protein 1, 150kD Oxygen-regulated Protein, 170kD Glucose-regulated Protein), Clone: [6F7], Mouse, Monoclonal

Artikelnummer: USB-128179
Artikelname: HYOU1 (GRP170, ORP150, Hypoxia Up-regulated Protein 1, 150kD Oxygen-regulated Protein, 170kD Glucose-regulated Protein), Clone: [6F7], Mouse, Monoclonal
Artikelnummer: USB-128179
Hersteller Artikelnummer: 128179
Alternativnummer: USB-128179-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IHC, WB
Immunogen: Partial recombinant protein corresponding to aa901-999 from human HYOU1 (NM_006389, NP_006380) with GST tag. MW of the GST tag alone is 26kD.
HYOU1 belongs to the heat shock protein 70 family. The protein is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This signal peptide-lacking protein, which is only 3aa shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry (FFPE): 1ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [6F7]
NCBI: 006389
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.4.