FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11) (HRP), Rabbit

Artikelnummer: USB-126598-HRP
Artikelname: FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11) (HRP), Rabbit
Artikelnummer: USB-126598-HRP
Hersteller Artikelnummer: 126598-HRP
Alternativnummer: USB-126598-HRP-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human FAM3B, aa1-235 (NP_478066.3).
FAM3B has delayed effects on beta-cell function, inhibiting basal insulin secretion from a beta-cell line in a dose-dependent manner. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 058186
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).