FAIM3 (Fas Apoptotic Inhibitory Molecule 3, Regulator of Fas-induced Apoptosis Toso, TOSO) (PE), Clone: [1E4], Mouse, Monoclonal

Artikelnummer: USB-126581-PE
Artikelname: FAIM3 (Fas Apoptotic Inhibitory Molecule 3, Regulator of Fas-induced Apoptosis Toso, TOSO) (PE), Clone: [1E4], Mouse, Monoclonal
Artikelnummer: USB-126581-PE
Hersteller Artikelnummer: 126581-PE
Alternativnummer: USB-126581-PE-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant protein corresponding to aa124-223 from human FAIM3 (AAH06401, BC006401) with GST tag. MW of the GST tag alone is 26kD.
May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQ Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1E4]
NCBI: 06401
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).