FAIM2 (KIAA0950, LFG, LFG2, NMP35, TMBIM2, Protein Lifeguard 2, Fas Apoptotic Inhibitory Molecule 2, Neural Membrane Protein 35, Transmembrane BAX Inhibitor Motif-containing Protein 2) (PE), Clone: [2C2], Mouse, Monoclonal100 u

Artikelnummer: USB-126578-PE
Artikelname: FAIM2 (KIAA0950, LFG, LFG2, NMP35, TMBIM2, Protein Lifeguard 2, Fas Apoptotic Inhibitory Molecule 2, Neural Membrane Protein 35, Transmembrane BAX Inhibitor Motif-containing Protein 2) (PE), Clone: [2C2], Mouse, Monoclonal100 u
Artikelnummer: USB-126578-PE
Hersteller Artikelnummer: 126578-PE
Alternativnummer: USB-126578-PE-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Full-length recombinant corresponding to aa1-317 from FAIM2 (AAH00051) with GST tag. MW of the GST tag alone is 26kD.
FAIM2 protects cells uniquely from Fas-induced apoptosis. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHA Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2C2]
NCBI: 000051
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).