FAHD2A (Fumarylacetoacetate Hydrolase Domain-containing Protein 2A, CGI-105, MGC131995), Mouse

Artikelnummer: USB-126577
Artikelname: FAHD2A (Fumarylacetoacetate Hydrolase Domain-containing Protein 2A, CGI-105, MGC131995), Mouse
Artikelnummer: USB-126577
Hersteller Artikelnummer: 126577
Alternativnummer: USB-126577-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human FAHD2A, aa1-314 (AAH09403.1).
Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLVSGRRRLLTVLLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPVLPRSEVTFLAPVTRPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWQMRRNGKQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 009403
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.