FAF1 (FAS-associated Factor 1, hFAF1, UBX Domain-containing Protein 12, UBX Domain-containing Protein 3A, UBXD12, UBXN3A, CGI-03, FLJ37524) (MaxLight 650), Clone: [1A10], Mouse, Monoclonal

Artikelnummer: USB-126575-ML650
Artikelname: FAF1 (FAS-associated Factor 1, hFAF1, UBX Domain-containing Protein 12, UBX Domain-containing Protein 3A, UBXD12, UBXN3A, CGI-03, FLJ37524) (MaxLight 650), Clone: [1A10], Mouse, Monoclonal
Artikelnummer: USB-126575-ML650
Hersteller Artikelnummer: 126575-ML650
Alternativnummer: USB-126575-ML650-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IF, WB
Immunogen: Partial recombinant corresponding to aa551-651 from human FAF1 (NP_008982) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. FAF1 (Fas-associated protein factor 1) specifically interacts with the cytoplasmic domain of wild type, but not mutated, Fas in both yeast and mammalian cells. When transiently expressed in T cells, FAF1 potentiates Fas-induced apoptosis. In contrast to TRADD, FADD, and RIP, FAF1 lacks a DDH (Death domain homologous region) and cannot induce apoptosis independent of Fas activation. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1A10]
NCBI: 007051
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)650.