FADD (Fas-Associated Death Domain Protein, Growth-inhibiting Gene 3 Protein, GIG3, Mediator of Receptor Induced Toxicity, MORT1, MGC8528, Protein FADD), IgG1, Clone: [3A12], Mouse, Monoclonal
Artikelnummer:
USB-126568
- Bilder (0)
| Artikelname: | FADD (Fas-Associated Death Domain Protein, Growth-inhibiting Gene 3 Protein, GIG3, Mediator of Receptor Induced Toxicity, MORT1, MGC8528, Protein FADD), IgG1, Clone: [3A12], Mouse, Monoclonal |
| Artikelnummer: | USB-126568 |
| Hersteller Artikelnummer: | 126568 |
| Alternativnummer: | USB-126568-100 |
| Hersteller: | US Biological |
| Wirt: | Mouse |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Immunogen: | Partial recombinant corresponding to aa109-208 from FADD (AAH00334) with GST tag. MW of the GST tag alone is 26kD. |
| FADD (Fas-associated protein with death domain) is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. This protein is implicated in survival/proliferation and cell cycle progression. FADD functions are also regulated via cellular sublocalization, protein phosphorylation, and inhibitory molecules. Recombinant FADD protein was expressed in E. coli and purified by using conventional chromatography techniques. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. |
Produktgarantie und fachkundiger Support
