FADD (Fas-Associated Death Domain Protein, Growth-inhibiting Gene 3 Protein, GIG3, Mediator of Receptor Induced Toxicity, MORT1, MGC8528, Protein FADD) (PE), Rabbit
Artikelnummer:
USB-126567-PE
- Bilder (0)
| Artikelname: | FADD (Fas-Associated Death Domain Protein, Growth-inhibiting Gene 3 Protein, GIG3, Mediator of Receptor Induced Toxicity, MORT1, MGC8528, Protein FADD) (PE), Rabbit |
| Artikelnummer: | USB-126567-PE |
| Hersteller Artikelnummer: | 126567-PE |
| Alternativnummer: | USB-126567-PE-100 |
| Hersteller: | US Biological |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Immunogen: | Full length human FADD, aa1-208 (NP_003815.1). |
| FADD (Fas-associated protein with death domain) is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. This protein is implicated in survival/proliferation and cell cycle progression. FADD functions are also regulated via cellular sublocalization, protein phosphorylation, and inhibitory molecules. Recombinant FADD protein was expressed in E. coli and purified by using conventional chromatography techniques. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody. |
Produktgarantie und fachkundiger Support
