APBB2 (Amyloid beta A4 Precursor Protein-binding Family B Member 2, Protein Fe65-like 1, FE65L, FE65L1) (APC), Clone: [2D8], Mouse, Monoclonal

Artikelnummer: USB-123388-APC
Artikelname: APBB2 (Amyloid beta A4 Precursor Protein-binding Family B Member 2, Protein Fe65-like 1, FE65L, FE65L1) (APC), Clone: [2D8], Mouse, Monoclonal
Artikelnummer: USB-123388-APC
Hersteller Artikelnummer: 123388-APC
Alternativnummer: USB-123388-APC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa1-100 from human APBB2 (AAH27946) with GST tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLV Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2D8]
NCBI: 027946
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).