AP3B1 (AP-3 Complex Subunit beta-1, Adapter-related Protein Complex 3 Subunit beta-1, Adaptor Protein Complex AP-3 Subunit beta-1, Beta-3A-adaptin, Clathrin Assembly Protein Complex 3 beta-1 Large Chain, ADTB3A) (Biotin), Clone: [

Artikelnummer: USB-123381-BIOTIN
Artikelname: AP3B1 (AP-3 Complex Subunit beta-1, Adapter-related Protein Complex 3 Subunit beta-1, Adaptor Protein Complex AP-3 Subunit beta-1, Beta-3A-adaptin, Clathrin Assembly Protein Complex 3 beta-1 Large Chain, ADTB3A) (Biotin), Clone: [
Artikelnummer: USB-123381-BIOTIN
Hersteller Artikelnummer: 123381-Biotin
Alternativnummer: USB-123381-BIOTIN-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa995-1095 from AP3B1 (NP_003655) with GST tag. MW of the GST tag alone is 26kD.
Subunit of non-clathrin- and clathrin-associated adaptor protein complex 3 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. AP-3 appears to be involved in the sorting of a subset of transmembrane proteins targeted to lysosomes and lysosome-related organelles. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG* Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3B4]
NCBI: 003664
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.