AP2B1 (AP-2 Complex Subunit beta, AP105B, Adapter-related Protein Complex 2 beta Subunit, Adaptor Protein Complex AP-2 Subunit beta, Beta-2-adaptin, Beta-adaptin, Clathrin Assembly Protein Complex 2 beta Large Chain, Plasma Membra
Artikelnummer:
USB-123379-ML550
Hersteller Artikelnummer:
123379-ML550
Alternativnummer:
USB-123379-ML550-100
Hersteller:
US Biological
Wirt:
Mouse
Kategorie:
Antikörper
Applikation:
FLISA, IHC, WB
Immunogen:
Partial recombinant corresponding to aa585-651 from human AP2B1 (NP_001273.1) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 beta subunit acts via its C-terminal appendage domain as a scaffolding platform for endocytic accessory proteins, at least some clathrin-associated sorting proteins (CLASPs) are recognized by their [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. The AP-2 beta subunit binds to clathrin heavy chain, promoting clathrin lattice assembly, clathrin displaces at least some CLASPs from AP2B1 which probably then can be positioned for further coat assembly. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.