AP1S2 (AP-1 Complex Subunit sigma-2, Adapter-related Protein Complex 1 sigma-1B Subunit, Adaptor Protein Complex AP-1 sigma-1B Subunit, Clathrin Assembly Protein Complex 1 sigma-1B Small Chain, Golgi Adaptor HA1/AP1 Adaptin sigma-

Artikelnummer: USB-123378-FITC
Artikelname: AP1S2 (AP-1 Complex Subunit sigma-2, Adapter-related Protein Complex 1 sigma-1B Subunit, Adaptor Protein Complex AP-1 sigma-1B Subunit, Clathrin Assembly Protein Complex 1 sigma-1B Small Chain, Golgi Adaptor HA1/AP1 Adaptin sigma-
Artikelnummer: USB-123378-FITC
Hersteller Artikelnummer: 123378-FITC
Alternativnummer: USB-123378-FITC-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA
Immunogen: Full length recombinant corresponding to aa1-158 from human AP1S2 (AAH01117) with GST tag. MW of the GST tag alone is 26kD.
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3B9-G5]
NCBI: 001117
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).