AP1S2 (AP-1 Complex Subunit sigma-2, Adapter-related Protein Complex 1 sigma-1B Subunit, Adaptor Protein Complex AP-1 sigma-1B Subunit, Clathrin Assembly Protein Complex 1 sigma-1B Small Chain, Golgi Adaptor HA1/AP1 Adaptin sigma-

Artikelnummer: USB-123378-BIOTIN
Artikelname: AP1S2 (AP-1 Complex Subunit sigma-2, Adapter-related Protein Complex 1 sigma-1B Subunit, Adaptor Protein Complex AP-1 sigma-1B Subunit, Clathrin Assembly Protein Complex 1 sigma-1B Small Chain, Golgi Adaptor HA1/AP1 Adaptin sigma-
Artikelnummer: USB-123378-BIOTIN
Hersteller Artikelnummer: 123378-Biotin
Alternativnummer: USB-123378-BIOTIN-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA
Immunogen: Full length recombinant corresponding to aa1-158 from human AP1S2 (AAH01117) with GST tag. MW of the GST tag alone is 26kD.
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [3B9-G5]
NCBI: 001117
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.