AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1) (HRP), Clone: [4B8], Mouse, Monoclonal

Artikelnummer: USB-123374-HRP
Artikelname: AOC3 (Membrane Primary Amine Oxidase, Copper Amine Oxidase, HPAO, Semicarbazide-sensitive Amine Oxidase, SSAO, Vascular Adhesion Protein 1, VAP-1, VAP1) (HRP), Clone: [4B8], Mouse, Monoclonal
Artikelnummer: USB-123374-HRP
Hersteller Artikelnummer: 123374-HRP
Alternativnummer: USB-123374-HRP-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA
Immunogen: Partial recombinant corresponding to aa351-451 from AOC3 (NP_003725) with GST tag. MW of the GST tag alone is 26kD.
Cell adhesion protein that participates in lymphocyte recirculation by mediating the binding of lymphocytes to peripheral lymph node vascular endothelial cells in an L-selectin-independent fashion. Has a monoamine oxidase activity. May play a role in adipogenesis. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSH* Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4B8]
NCBI: 003734
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).