VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, CAS [[2279952-25-7]] Preis auf Anfrage

Artikelnummer: TGM-T76250
Artikelname: VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, CAS [[2279952-25-7]] Preis auf Anfrage
Artikelnummer: TGM-T76250
Hersteller Artikelnummer: T76250
Alternativnummer: TGM-T76250-5MG,TGM-T76250-50MG
Hersteller: TargetMol
Kategorie: Biochemikalien
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of alpha2delta-1 and is recognized as the alpha2delta-1Tat peptide. It disrupts the alpha2delta-1 - NMDAR interaction both in vitro and in vivo, offering a potential research tool for neuropathic pain studies [1].
Molekulargewicht: 3490.06
CAS Nummer: [2279952-25-7]
Formel: C171H250N40O39
Target-Kategorie: iGluR
T76250
T76250