Vascular cell adhesion molecule 1, Human Recombinant HEK
Artikelnummer:
RAY-228-21749-2
| Artikelname: |
Vascular cell adhesion molecule 1, Human Recombinant HEK |
| Artikelnummer: |
RAY-228-21749-2 |
| Hersteller Artikelnummer: |
228-21749-2 |
| Alternativnummer: |
RAY-228-21749-2 |
| Hersteller: |
RayBiotech |
| Kategorie: |
Proteine/Peptide |
| Spezies Reaktivität: |
Human |
| Alternative Synonym: |
Vascular cell adhesion protein 1, V-CAM 1, INCAM-100, CD106, VCAM1, L1CAM, MGC99561, DKFZp779G2333. |
| NCBI: |
7412 |
| Expression System: |
HEK293 cells |
| Reinheit: |
Greater than 95% as determined by SDS-PAGE. |
| Formulierung: |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequenz: |
FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLI |
| Formel: |
VCAM1 was lyophilized from a 0.2 umfiltered solution of 20mM PB, 150mM NaCl, 2mM CaCl2, 2mM MgCl2 and 5%Threhalose, pH 7.2. |