Polyclonal Rabbit anti-Human DIAPH1 Antibody (IHC, WB) LS-C334279

Artikelnummer: LS-C334279-20
Artikelname: Polyclonal Rabbit anti-Human DIAPH1 Antibody (IHC, WB) LS-C334279
Artikelnummer: LS-C334279-20
Hersteller Artikelnummer: LS-C334279-20
Alternativnummer: LS-C334279-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1149-1263 of human DIAPH1 (NP_001073280.1). TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS
Konjugation: Unconjugated
Alternative Synonym: DIAPH1, DRF1, DIA1, Diaphanous-related formin 1, Diaphanous-related formin-1, DIAP1, Protein diaphanous homolog 1, DFNA1, HDIA1, LFHL1
DIAPH1 antibody LS-C334279 is an unconjugated rabbit polyclonal antibody to DIAPH1 from human. It is reactive with human and mouse. Validated for IHC and WB.
Klonalität: Polyclonal
NCBI: 1729
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 138kDa/140kDa/141kDa, while the observed MW by Western blot was 178kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded Mouse kidney tissue.