Polyclonal Rabbit anti-Human DIAPH1 Antibody (IHC, WB) LS-C334279

Artikelnummer: LS-C334279-100

Bilder (2)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human DIAPH1 Antibody (IHC, WB) LS-C334279
Artikelnummer:	LS-C334279-100
Hersteller Artikelnummer:	LS-C334279-100
Alternativnummer:	LS-C334279-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, WB
Spezies Reaktivität:	Human, Mouse
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1149-1263 of human DIAPH1 (NP_001073280.1). TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS
Konjugation:	Unconjugated
Alternative Synonym:	DIAPH1, DRF1, DIA1, Diaphanous-related formin 1, Diaphanous-related formin-1, DIAP1, Protein diaphanous homolog 1, DFNA1, HDIA1, LFHL1

DIAPH1 antibody LS-C334279 is an unconjugated rabbit polyclonal antibody to DIAPH1 from human. It is reactive with human and mouse. Validated for IHC and WB.

Klonalität:	Polyclonal
NCBI:	1729
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 138kDa/140kDa/141kDa, while the observed MW by Western blot was 178kDa.

	Western blot analysis of extracts of various cell lines.
	Immunohistochemistry of paraffin-embedded Mouse kidney tissue.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten