Polyclonal Rabbit anti-Human GNRH Antibody (IHC, WB) LS-C334177

Artikelnummer: LS-C334177-20
Artikelname: Polyclonal Rabbit anti-Human GNRH Antibody (IHC, WB) LS-C334177
Artikelnummer: LS-C334177-20
Hersteller Artikelnummer: LS-C334177-20
Alternativnummer: LS-C334177-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-92 of human GNRH1 (NP_001076580.1). QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Konjugation: Unconjugated
Alternative Synonym: GNRH1, Gonadoliberin, LHRH, LNRH, GnRH-associated peptide 1, Progonadoliberin-1, Progonadoliberin I, Luliberin I, GNRH, GRH, HH12
GNRH antibody LS-C334177 is an unconjugated rabbit polyclonal antibody to GNRH from human. It is reactive with human and mouse. Validated for IHC and WB.
Klonalität: Polyclonal
NCBI: 2796
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IHC (1:50 - 1:100), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 10kDa, while the observed MW by Western blot was 12kDa.
Western blot analysis of extracts of various tissues.
Immunohistochemistry of paraffin-embedded human prostate.