Polyclonal Rabbit anti-Human CYB5A / Cytochrome b5 Antibody (IHC, WB) LS-C334039

Artikelnummer: LS-C334039-100
Artikelname: Polyclonal Rabbit anti-Human CYB5A / Cytochrome b5 Antibody (IHC, WB) LS-C334039
Artikelnummer: LS-C334039-100
Hersteller Artikelnummer: LS-C334039-100
Alternativnummer: LS-C334039-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CYB5A (NP_683725.1). MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLI
Konjugation: Unconjugated
Alternative Synonym: CYB5A, CYB5, Cytochrome b5 (microsomal), MCB5, Type 1 cyt-b5, Cytochrome b-5, Cytochrome b5
Cytochrome b5 antibody LS-C334039 is an unconjugated rabbit polyclonal antibody to human Cytochrome b5 (CYB5A). Validated for IHC and WB.
Klonalität: Polyclonal
NCBI: 1528
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 11kDa/14kDa/15kDa, while the observed MW by Western blot was 17kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded human colon tissue.