Recombinant Human Liver carboxylesterase 1 (CES1) (Active)
Artikelnummer:
CSB-MP005258HU
| Artikelname: |
Recombinant Human Liver carboxylesterase 1 (CES1) (Active) |
| Artikelnummer: |
CSB-MP005258HU |
| Hersteller Artikelnummer: |
CSB-MP005258HU |
| Alternativnummer: |
CSB-MP005258HU-1, CSB-MP005258HU-100, CSB-MP005258HU-20 |
| Hersteller: |
Cusabio |
| Kategorie: |
Proteine/Peptide |
| Alternative Synonym: |
Liver carboxylesterase 1, Acyl-coenzyme A:cholesterol acyltransferase (ACAT), Brain carboxylesterase hBr1, Carboxylesterase 1 (CE-1, hCE-1) (EC:3.1.1.13 ) , Cholesteryl ester hydrolase 1 publication (CEH 1 publication) (EC:3.1.1.134), Cocaine carboxylesterase,CES1 ,CES2, SES1 |
| Molekulargewicht: |
62.0 kDa |
| Tag: |
C-terminal 10xHis-tagged |
| UniProt: |
P23141 |
| Puffer: |
Lyophilized from a 0.2 µm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6%Trehalose, pH 8.0. |
| Quelle: |
Mammalian cell |
| Expression System: |
18-567aa |
| Reinheit: |
Greater than 95% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC. |
| Formulierung: |
Lyophilized powder |
| Sequenz: |
GHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITA |
![]()
|
Measured by its ability to hydrolyze p-nitrophenylacetate. The specific activity is >40000 pmol/min/µg. |
![]()
|
The purity of CES1 was greater than 95% as determined by SEC-HPLC |
![]()
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
![]()
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
