Human TNFSF14 protein

Artikelnummer: BYT-ORB705344
Artikelname: Human TNFSF14 protein
Artikelnummer: BYT-ORB705344
Hersteller Artikelnummer: orb705344
Alternativnummer: BYT-ORB705344-20,BYT-ORB705344-100,BYT-ORB705344-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (Herpes virus entry mediator ligand)(HVEM-L)(Herpesvirus entry mediator ligand)(CD258)(HVEML)(LIGHT)(UNQ391)(PRO726)
This Human TNFSF14 protein spans the amino acid sequence from region 74-240aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 46.7 kDa
UniProt: O43557
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 at 5 µg/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
orb705344
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 at 5 µg/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml.