Human Tnfrsf17 protein
Artikelnummer:
BYT-ORB624119
- Bilder (5)
| Artikelname: | Human Tnfrsf17 protein |
| Artikelnummer: | BYT-ORB624119 |
| Hersteller Artikelnummer: | orb624119 |
| Alternativnummer: | BYT-ORB624119-20,BYT-ORB624119-100,BYT-ORB624119-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | B-cell maturation protein (CD_antigen: CD269) |
| This Human Tnfrsf17 protein spans the amino acid sequence from region 1-54aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 34.8 kDa |
| UniProt: | Q02223 |
| Puffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Lyophilized powder |
| Sequenz: | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 µg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |





