Human ITIH4 protein

Artikelnummer: BYT-ORB605484
Artikelname: Human ITIH4 protein
Artikelnummer: BYT-ORB605484
Hersteller Artikelnummer: orb605484
Alternativnummer: BYT-ORB605484-1,BYT-ORB605484-100,BYT-ORB605484-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Inter-alpha-trypsin inhibitor family heavy chain-related protein
This Human ITIH4 protein spans the amino acid sequence from region 689-930aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 28.9 kDa
UniProt: Q14624
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) ITIH4.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) ITIH4.
The purity of ITIH4 was greater than 90% as determined by SEC-HPLC