Human IL7 protein

Artikelnummer: BYT-ORB594803
Artikelname: Human IL7 protein
Artikelnummer: BYT-ORB594803
Hersteller Artikelnummer: orb594803
Alternativnummer: BYT-ORB594803-10,BYT-ORB594803-50,BYT-ORB594803-500,BYT-ORB594803-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-7, IL-7, IL7
This Human IL7 protein spans the amino acid sequence from region 26-177aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 18.4 kDa
UniProt: P13232
Puffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood mononuclear cell (PBMC) is 50-300 pg/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL