Human LIF protein

Artikelnummer: BYT-ORB594754
Artikelname: Human LIF protein
Artikelnummer: BYT-ORB594754
Hersteller Artikelnummer: orb594754
Alternativnummer: BYT-ORB594754-10,BYT-ORB594754-50,BYT-ORB594754-500,BYT-ORB594754-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Leukemia Inhibitory Factor, LIF, Differentiation-Stimulating Factor, D Factor, Melanoma-Derived LPL Inhibitor, MLPLI, Emfilermin, LIF, HILDA
This Human LIF protein spans the amino acid sequence from region 23-202aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 19.7 kDa
UniProt: P15018
Puffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, 0.02% Tween 20, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is 25-150 pg/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL