NFATC3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB592964
- Bilder (6)
| Artikelname: | NFATC3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB592964 |
| Hersteller Artikelnummer: | orb592964 |
| Alternativnummer: | BYT-ORB592964-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC3 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NFAT4, NFATX, NF-AT4c |
| Rabbit polyclonal antibody to NFATC3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 115kDa |
| NCBI: | 004546 |
| UniProt: | B5B2S0 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI |
| Target-Kategorie: | NFATC3 |
|
|
Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml. |
|
|
Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml. |
|
|
Immunohistochemistry with Thymus tissue at an antibody concentration of 5 ug/ml using anti-NFATC3 antibody (orb592964). |
|
|
Rabbit Anti-NFATC3 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
WB Suggested Anti-NFATC3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate. |
Produktgarantie und fachkundiger Support
