IRF8 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB592900
- Bilder (7)
| Artikelname: | IRF8 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB592900 |
| Hersteller Artikelnummer: | orb592900 |
| Alternativnummer: | BYT-ORB592900-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human IRF8 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ICSBP, IRF-8, ICSBP1, IMD32A, IMD32B, H-ICSBP |
| Rabbit polyclonal antibody to IRF8 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 48kDa |
| NCBI: | 002154 |
| UniProt: | Q02556 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC |
| Target-Kategorie: | IRF8 |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 37 kDa and the protein may also be ubiquitinated. |
|
|
Sample Tissue: Human DLD1 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml. |
|
|
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml. |
|
|
Immunohistochemistry with Human Intestine tissue. |
|
|
Immunohistochemistry with Human Liver cell lysate tissue. |
|
|
WB Suggested Anti-IRF8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. |
Produktgarantie und fachkundiger Support
