NR2F2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB592891
- Bilder (7)
| Artikelname: | NR2F2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB592891 |
| Hersteller Artikelnummer: | orb592891 |
| Alternativnummer: | BYT-ORB592891-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ARP1, ARP-1, CHTD4, NF-E3, SRXX5, SVP40, COUPTF2, COUPTFB, TFCOUP2, COUPTFII |
| Rabbit polyclonal antibody to NR2F2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 45kDa |
| NCBI: | 066285 |
| UniProt: | P24468 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP |
| Target-Kategorie: | NR2F2 |
|
|
Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml. |
|
|
Positive control (+): 293T (2T), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml. |
|
|
Rabbit Anti-NR2F2 antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: alveolar cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X. |
|
|
Rabbit Anti-NR2F2 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
Produktgarantie und fachkundiger Support
