ETS1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB592832
- Bilder (6)
| Artikelname: | ETS1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB592832 |
| Hersteller Artikelnummer: | orb592832 |
| Alternativnummer: | BYT-ORB592832-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human ETS1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | p54, ETS-1, EWSR2, c-ets-1 |
| Rabbit polyclonal antibody to ETS1 |
| Klonalität: | Polyclonal |
| Konzentration: | 1.0 mg/ml |
| Molekulargewicht: | 50kDa |
| NCBI: | 005229 |
| UniProt: | P14921 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN |
| Target-Kategorie: | ETS1 |
|
|
Sample Tissue: Human NCI-H226 Whole Cell, Antibody Dilution: 7 ug/ml. |
|
|
Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml. |
|
|
Human kidney |
|
|
Human Pancrease |
|
|
Rabbit Anti-ETS1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
WB Suggested Anti-ETS1 Antibody Titration: 1.0 ug/ml, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
