PRDM1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB592827
- Bilder (7)
| Artikelname: | PRDM1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB592827 |
| Hersteller Artikelnummer: | orb592827 |
| Alternativnummer: | BYT-ORB592827-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human PRDM1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BLIMP1, PRDI-BF1 |
| Rabbit polyclonal antibody to PRDM1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 92 kDa |
| NCBI: | 878911 |
| UniProt: | Q86WM7 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES |
| Target-Kategorie: | PRDM1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 77 kDa isoform. The protein may be modified by glycosylation. |
|
|
Anti-BLIMP-1 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
|
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 3 ug/ml. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 3 ug/ml. |
|
|
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 3 ug/ml. |
|
|
Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-PRDM1 antibody (orb592827). |
|
|
WB Suggested Anti-PRDM1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: SH-SYSY cell lysate. |
Produktgarantie und fachkundiger Support
