Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: MFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCT
Target-Kategorie:
FOS
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation and phosphorylation.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.
Rabbit Anti-FOS Antibody, Catalog Number: orb592712, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Nucleus in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
