RPL36AL Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB586422
- Bilder (7)
| Artikelname: | RPL36AL Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB586422 |
| Hersteller Artikelnummer: | orb586422 |
| Alternativnummer: | BYT-ORB586422-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPL36AL |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RPL36A |
| Rabbit polyclonal antibody to RPL36AL |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 12kDa |
| NCBI: | 000992 |
| UniProt: | Q969Q0 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: FRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQ |
| Target-Kategorie: | RPL36AL |
|
|
Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. RPL36AL is supported by BioGPS gene expression data to be expressed in HEK293T. |
|
|
Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. RPL36AL is supported by BioGPS gene expression data to be expressed in 721_B. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
WB Suggested Anti-RPL36AL Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell. RPL36AL is supported by BioGPS gene expression data to be expressed in Jurkat. |
Produktgarantie und fachkundiger Support
