CYP11B1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB584585
| Artikelname: |
CYP11B1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB584585 |
| Hersteller Artikelnummer: |
orb584585 |
| Alternativnummer: |
BYT-ORB584585-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human, Monkey |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human CYP11B1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
FHI, CPN1, CYP11B, P450C11 |
| Rabbit polyclonal antibody to CYP11B1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
58 kDa |
| NCBI: |
000488 |
| UniProt: |
P15538 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL |
| Target-Kategorie: |
CYP11B1 |
![]()
|
Sample type: 1. HEK293TN-GFP-hcyp11B1 (75 ug), 2. HEK293TN-GFP-hcyp11B2 (75 ug), Primary dilution: 1:100, Secondary Antibody: mouse anti-Rabbit HRP, Secondary dilution: 1:10000, Film Exposed for: 5 minutes. |
![]()
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. |
![]()
|
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml. |
![]()
|
Sample Type: Monkey adrenal gland, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus, Gene Name: CYP11B1. |
![]()
|
Sample Type: Monkey vagina, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus, Gene Name: CYP11B1. |
![]()
|
WB Suggested Anti-CYP11B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver. |
