Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: PYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Target-Kategorie:
MAPK1
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. MAPK1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.
Rabbit Anti-MAPK1 Antibody, Catalog Number: orb584155, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
