HSPA9 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB573591
Artikelname: HSPA9 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB573591
Hersteller Artikelnummer: orb573591
Alternativnummer: BYT-ORB573591-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA9
Konjugation: Unconjugated
Alternative Synonym: CSA, MOT, MOT2, SAAN, CRP40, EVPLS, GRP75, PBP74, GRP-75, HSPA9B, SIDBA4, MTHSP75, HEL-S-124m
Rabbit polyclonal antibody to HSPA9
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 75kDa
NCBI: 004125
UniProt: P38646
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ
Target-Kategorie: HSPA9
Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: HSPA9, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: HSPA9.
Sample Type: rat brain extract (80 ug), Primary antibody dilution: 2 ug/ml, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody dilution: 1:20000.
Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: HSPA9: Red DAPI:Blue, Gene Name: HSPA9.
Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: HSPA9: Red DAPI:Blue, Gene Name: HSPA9.
Skeletal muscle
WB Suggested Anti-HSPA9 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, HSPA9 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.