GLIS2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB573560
- Bilder (6)
| Artikelname: | GLIS2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB573560 |
| Hersteller Artikelnummer: | orb573560 |
| Alternativnummer: | BYT-ORB573560-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NKL, NPHP7 |
| Rabbit polyclonal antibody to GLIS2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 56 kDa |
| NCBI: | 115964 |
| UniProt: | Q9BZE0 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE |
| Target-Kategorie: | GLIS2 |
|
|
25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/ml. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Ovary Tumor, Antibody dilution: 1.0 ug/ml. |
|
|
Positive control (+): Human Ovary Tumor (T-OV), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 3 ug/ml. |
|
|
Sample Type: Human Bile DuctPrimary, dilution: 1:500. |
|
|
WB Suggested Anti-GLIS2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
