Human IL 13 Protein

Artikelnummer: BYT-ORB429400
Artikelname: Human IL 13 Protein
Artikelnummer: BYT-ORB429400
Hersteller Artikelnummer: orb429400
Alternativnummer: BYT-ORB429400-1,BYT-ORB429400-10,BYT-ORB429400-2
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.
Recombinant of human IL13 protein
Puffer: The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.
Reinheit: Greater than 95% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Anwendungsbeschreibung: Solubility: It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be 1 x 106units/mg. Application Notes: Protein content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.57 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a calibrated solution of IL-13 as a Reference Standard