Human VEGI Protein

Artikelnummer: BYT-ORB429203
Artikelname: Human VEGI Protein
Artikelnummer: BYT-ORB429203
Hersteller Artikelnummer: orb429203
Alternativnummer: BYT-ORB429203-1,BYT-ORB429203-20,BYT-ORB429203-5
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Tumor necrosis factor ligand superfamily member 15, TNFSF-15, TNFSF15, TNF ligand-related molecule 1, VEGI, TL-1, TL1, TL1A, VEGI192A, VEGI-192, MGC129934, MGC129935.
Recombinant of human VEGI protein
Puffer: The TNFSF15 was lyophilized from a 0.2µm filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20.
Reinheit: Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Anwendungsbeschreibung: Solubility: It is recommended to reconstitute the lyophilized TNFSF15 in sterile 18MO-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. Biological Activity: The ED50 as determined by its ability to induce apoptosis using human TF-1 cells is less than 20ng/ml, corresponding to a specific activity of > 5.0*104 IU/mg. Application Notes: Cytokines And Growth Factors