VEGF C Protein

Artikelnummer: BYT-ORB429181
Artikelname: VEGF C Protein
Artikelnummer: BYT-ORB429181
Hersteller Artikelnummer: orb429181
Alternativnummer: BYT-ORB429181-1,BYT-ORB429181-10,BYT-ORB429181-2
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L.
Recombinant of VEGF C protein
Puffer: Each mg of VEGF-C Rat contains 50mg rAlbumin and PBS as buffer.
Reinheit: Greater than 90.0% as determined by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH
Anwendungsbeschreibung: Solubility: It is recommended to reconstitute the lyophilized Vascular Endothelial Growth Factor C in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Biological Activity: Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg. Application Notes: Cytokines And Growth Factors