Viral Polymerase acidic protein
Artikelnummer:
BYT-ORB419359
- Bilder (3)
| Artikelname: | Viral Polymerase acidic protein |
| Artikelnummer: | BYT-ORB419359 |
| Hersteller Artikelnummer: | orb419359 |
| Alternativnummer: | BYT-ORB419359-20,BYT-ORB419359-100,BYT-ORB419359-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | RNA-directed RNA polymerase subunit P2 |
| This Viral Polymerase acidic protein spans the amino acid sequence from region 124-247aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 18.6 kDa |
| UniProt: | Q9IQ47 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Influenza A virus (strain A/x-31 H3N2) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS |
| Anwendungsbeschreibung: | Biological Origin: Influenza A virus (strain A/x-31 H3N2). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 124-247aaSequence Info: Full Length |



