Viral Nucleoprotein protein

Artikelnummer: BYT-ORB419345
Artikelname: Viral Nucleoprotein protein
Artikelnummer: BYT-ORB419345
Hersteller Artikelnummer: orb419345
Alternativnummer: BYT-ORB419345-20,BYT-ORB419345-100,BYT-ORB419345-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Nucleocapsid protein
This Viral Nucleoprotein protein spans the amino acid sequence from region 488-739aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 31.1 kDa
UniProt: P18272
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ
Anwendungsbeschreibung: Biological Origin: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 488-739aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) NP.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) NP.